PDB entry 1c1z

View 1c1z on RCSB PDB site
Description: crystal structure of human beta-2-glycoprotein-I (apolipoprotein-h)
Class: signaling protein
Keywords: glycoprotein, short consensus repeat, scr, sushi domain, complement control protein module, ccp, signaling protein
Deposited on 1999-07-22, released 1999-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta2-glycoprotein-I
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB X58100 (0-325)
    Domains in SCOPe 2.07: d1c1za1, d1c1za2, d1c1za3, d1c1za4, d1c1za5
  • Heterogens: NDG, NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c1zA (A:)
    grtcpkpddlpfstvvplktfyepgeeitysckpgyvsrggmrkficpltglwpintlkc
    tprvcpfagilengavryttfeypntisfscntgfylngadsakcteegkwspelpvcap
    iicpppsiptfatlrvykpsagnnslyrdtavfeclpqhamfgndtitctthgnwtklpe
    crevkcpfpsrpdngfvnypakptlyykdkatfgchdgysldgpeeiectklgnwsamps
    ckascklpvkkatvvyqgervkiqekfkngmlhgdkvsffcknkekkcsytedaqcidgt
    ievpkcfkehsslafwktdasdvkpc