PDB entry 1c1x

View 1c1x on RCSB PDB site
Description: l-phenylalanine dehydrogenase structure in ternary complex with nad+ and l-3-phenyllactate
Class: oxidoreductase
Keywords: amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase
Deposited on 1999-07-22, released 2000-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.183
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-phenylalanine dehydrogenase
    Species: Rhodococcus sp. [TaxId:1831]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c1xa1, d1c1xa2
  • Chain 'B':
    Compound: protein (l-phenylalanine dehydrogenase)
    Species: Rhodococcus sp. [TaxId:1831]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c1xb1, d1c1xb2
  • Heterogens: K, NA, PO4, HFA, NAD, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c1xA (A:)
    sidsalnwdgemtvtrfdsmtgahfvirldstqlgpaaggtraaqysnladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareastttata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c1xA (A:)
    sidsalnwdgemtvtrfdsmtgahfvirldstqlgpaaggtraaqysnladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrarea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c1xB (B:)
    sidsalnwdgemtvtrfdkmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareastttata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c1xB (B:)
    sidsalnwdgemtvtrfdkmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrare