PDB entry 1c1t

View 1c1t on RCSB PDB site
Description: recruiting zinc to mediate potent, specific inhibition of serine proteases
Class: hydrolase/hydrolase inhibitor
Keywords: zn(II)-mediated serine protease inhibitors, ph dependence, zn(II) affinity stucture-based drug design, serine protease/inhibitor
Deposited on 1999-07-21, released 2000-07-26
The last revision prior to the SCOP 1.73 freeze date was dated 2001-09-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.174
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1c1ta_
  • Heterogens: CA, MG, SO4, BAB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c1tA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn