PDB entry 1c1p

View 1c1p on RCSB PDB site
Description: recruiting zinc to mediate potent, specific inhibition of serine proteases
Class: hydrolase/hydrolase inhibitor
Keywords: zn(II)-mediated serine protease inhibitors, ph dependence, zn(II) affinity stucture-based drug design, serine protease serine protease/inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 1999-07-21, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c1pa_
  • Heterogens: CA, MG, SO4, BAI, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c1pA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn