PDB entry 1c1k

View 1c1k on RCSB PDB site
Description: bacteriophage t4 gene 59 helicase assembly protein
Class: DNA binding protein
Keywords: helicase assembly, DNA replication, DNA recombination, forked DNA, DNA binding protein
Deposited on 1999-07-22, released 2000-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.2
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bpt4 gene 59 helicase assembly protein
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c1ka_
  • Heterogens: IR, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c1kA (A:)
    miklrmpaggeryidgksvyklylmikqhmngkydvikynwcmrvsdaayqkrrdkyffq
    klsekyklkelalifisnlvanqdawigdisdadalvfyreyigrlkqikfkfeedirni
    yyfskkvevsafkeifeynpkvqssyifkllqsniisfetfilldsflniidkhdeqtdn
    lvwnnysiklkayrkilnidsqkaknvfietvkscky