PDB entry 1c1h

View 1c1h on RCSB PDB site
Description: crystal structure of bacillus subtilis ferrochelatase in complex with n-methyl mesoporphyrin
Class: lyase
Keywords: rossmann fold, alpha/beta fold, ferrochelatase, heme synthesis, porphyrin metallation, pi-helix, lyase
Deposited on 1999-07-22, released 2000-03-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c1ha_
  • Heterogens: MG, MMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c1hA (A:)
    msrkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqit
    eqqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstf
    svqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamliv
    sahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltr
    dlfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidal
    atvvlkklgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c1hA (A:)
    kmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteqqa
    hnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsvqs
    ynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsahs
    lpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdlfe
    qkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalatvv
    lkklgr