PDB entry 1c1f

View 1c1f on RCSB PDB site
Description: ligand-free congerin i
Deposited on 1999-03-03, released 1999-10-08
The last revision prior to the SCOP 1.61 freeze date was dated 1999-10-14, with a file datestamp of 1999-10-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1c1fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c1fA (A:)
gglqvknfdftvgkfltvggfinnspqrfsvnvgesmnslslhldhrfnygadqntivmn
stlkgdngweteqrstnftlsagqyfeitlsydinkfyidildgpnlefpnryskeflpf
lslagdarltlvkle