PDB entry 1c1e

View 1c1e on RCSB PDB site
Description: crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten
Class: immune system
Keywords: catalytic antibody, diels-alder, immunoglobulin
Deposited on 1999-07-22, released 2000-03-01
The last revision prior to the SCOP 1.75 freeze date was dated 2000-10-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.239
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: catalytic antibody 1e9 (heavy chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1c1eh1, d1c1eh2
  • Chain 'L':
    Compound: catalytic antibody 1e9 (light chain)
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1c1el1, d1c1el2
  • Heterogens: ENH, DMR, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c1eH (H:)
    qiqlvqsgpelkkpgetvkisckasgymftnygmnwvkqapgkalklmgwinpytgestf
    addfkgrfaffletsattaylqinnlknedmatyfcargttivramdywgqgtsltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c1eL (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
    sgvpdrfggsgsgtdfilkisrveaedlgvyfcfqsthffptfgggtkleiksadaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr