PDB entry 1c1d

View 1c1d on RCSB PDB site
Description: l-phenylalanine dehydrogenase structure in ternary complex with nadh and l-phenylalanine
Class: oxidoreductase
Keywords: amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase
Deposited on 1999-07-21, released 2000-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.195
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-phenylalanine dehydrogenase
    Species: Rhodococcus sp. [TaxId:1831]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c1da1, d1c1da2
  • Chain 'B':
    Compound: l-phenylalanine dehydrogenase
    Species: Rhodococcus sp. [TaxId:1831]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c1db1, d1c1db2
  • Heterogens: K, PHE, NAI, NA, PO4, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c1dA (A:)
    sidsalnwdgemtvtrfdamtgahfvirldstqlgpaaggtraaqysnladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareastttata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c1dA (A:)
    sidsalnwdgemtvtrfdamtgahfvirldstqlgpaaggtraaqysnladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c1dB (B:)
    sidsalnwdgemtvtrfdsmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrareastttata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c1dB (B:)
    sidsalnwdgemtvtrfdsmtgahfvirldstqlgpaaggtraaqysqladaltdagkla
    gamtlkmavsnlpmgggksvialpaprhsidpstwarilrihaenidklsgnywtgpdvn
    tnsadmdtlndttefvfgrslerggagssafttavgvfeamkatvahrglgsldgltvlv
    qglgavggslaslaaeagaqllvadtdtervahavalghtavaledvlstpcdvfapcam
    ggvittevartldcsvvagaannviadeaasdilhargilyapdfvanaggaihlvgrev
    lgwsesvvheravaigdtlnqvfeisdndgvtpdeaartlagrrarea