PDB entry 1c1c

View 1c1c on RCSB PDB site
Description: crystal structure of hiv-1 reverse transcriptase in complex with tnk-6123
Class: transferase
Keywords: hiv-1 reverse transcriptase, aids, non-nucleoside inhibitor, drug design, transferase
Deposited on 1999-07-21, released 2000-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 reverse transcriptase (a-chain)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-End)
      • modified residue (279)
    Domains in SCOPe 2.07: d1c1ca1, d1c1ca2
  • Chain 'B':
    Compound: hiv-1 reverse transcriptase (b-chain)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c1cb_
  • Heterogens: 612, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c1cA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c1cA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkktkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplde
    dfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyq
    ymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvq
    pivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaele
    laenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgaht
    ndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntppl
    vklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqai
    ylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c1cB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c1cB (B:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwgiphpaglkkkksvtvldvgdayfsvpldedfrkyt
    aftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddly
    vgsdleigqhrtkieelrqhllrwgltyelhpdkwtvqpivlpekdswtvndiqklvgkl
    nwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskd
    liaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwg
    ktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqlekepivgaetf