PDB entry 1c1b

View 1c1b on RCSB PDB site
Description:
Deposited on 1999-07-21, released 2000-07-21
The last revision prior to the SCOP 1.71 freeze date was dated 2000-07-21, with a file datestamp of 2000-07-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1c1ba1, d1c1ba2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1c1bb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c1bA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c1bA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkwrklvdfrelnkrtqdfwqlgiphpaglkkkksvtvldvgdayfsvpldedfrk
    ytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymdd
    lyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivl
    pekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaen
    reilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvk
    qlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklw
    yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal
    qdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c1bB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwynlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c1bB (B:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwgiphpaglkkkksvtvldvgdayfsvpldedfrkyt
    aftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqymddly
    vgsdleigqhrtkieelrqhllrwglttpgyelhpdkwtvqpivlpekdswtvndiqklv
    gklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydp
    skdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiv
    iwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwynlekepivg