PDB entry 1c15

View 1c15 on RCSB PDB site
Description: solution structure of apaf-1 card
Class: apoptosis
Keywords: programmed cell death, apaf, card, ded, dd, caspase recruitment domain, homophilic interaction, apoptosis
Deposited on 1999-07-20, released 1999-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptotic protease activating factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c15a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c15A (A:)
    mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
    lkkdndsyvsfynallhegykdlaallhdgipvvsss