PDB entry 1c13

View 1c13 on RCSB PDB site
Description: structure on native (asn 87) subtilisin from bacillus lentus
Class: hydrolase
Keywords: subtilisins, altered flexibility
Deposited on 1999-07-20, released 1999-09-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2001-04-18, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.148
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin
    Species: Bacillus lentus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29600 (0-268)
      • engineered mutation (84)
    Domains in SCOPe 2.08: d1c13a_
  • Heterogens: SUL, CA, MSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c13A (A:)
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapnaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr