PDB entry 1c12

View 1c12 on RCSB PDB site
Description:
Deposited on 1999-07-20, released 1999-08-14
The last revision prior to the SCOP 1.65 freeze date was dated 2000-01-31, with a file datestamp of 2000-01-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1c12a1, d1c12a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1c12b1, d1c12b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c12A (A:)
    dieltqspssmsvslgdtvsitchasqgissnigwlqqkpgksfkgliyhgtnledgvps
    rfsgsgsgadysltisslesedfadyycvqyvqfpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c12B (B:)
    qvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyisysgstsy
    spslksrisltrdtsknqfflqlnsvttedtatyycvtsltwllrrkrsywgqgttvtvs
    sastkgpsvyplapgskaaasmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivpe