PDB entry 1c12

View 1c12 on RCSB PDB site
Description: insight in odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide
Class: immune system
Keywords: antibody-antigen complex, scfv fragment, cdrh3, musk odorant, odorant specificity, immune system
Deposited on 1999-07-20, released 1999-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (antibody fragment fab)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1C12 (0-213)
    Domains in SCOPe 2.08: d1c12a1, d1c12a2
  • Chain 'B':
    Compound: protein (antibody fragment fab)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1C12 (0-219)
    Domains in SCOPe 2.08: d1c12b1, d1c12b2, d1c12b3
  • Heterogens: TRZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c12A (A:)
dieltqspssmsvslgdtvsitchasqgissnigwlqqkpgksfkgliyhgtnledgvps
rfsgsgsgadysltisslesedfadyycvqyvqfpftfgsgtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrnea

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c12B (B:)
qvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyisysgstsy
spslksrisltrdtsknqfflqlnsvttedtatyycvtsltwllrrkrsywgqgttvtvs
sastkgpsvyplapgskaaasmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivpe