PDB entry 1c0t

View 1c0t on RCSB PDB site
Description:
Deposited on 1999-07-19, released 2000-07-19
The last revision prior to the SCOP 1.65 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1c0ta1, d1c0ta2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1c0tb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c0tA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0tA (A:)
    pietvpvklkpgmdgpkvkqwpltgkisnpyntpvfaklvdfrelnkrtqdfwevqlgip
    hpaglkkkksvtvldvgdayfsvpldedfrkytafyqynvlpqgwkgspaifqssmtkil
    epfrkqnpdiviyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppfl
    wmgyelhpdkwtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtka
    lteviplteeaelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfkn
    lktgkyarmrgahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqa
    twipewefvntpplvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvt
    ltdttnqktelqaiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikk
    ekvylawvpah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c0tB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0tB (B:)
    etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikk
    kdstkwrklvdfrelnkrtqdfhpaglkkkksvtvldvgdayfsvpldedfrkytaftip
    sinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgelh
    pdkwtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkaltevipl
    teeaelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkya
    rmrgahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewe
    fvntpplvklwyq