PDB entry 1c0p

View 1c0p on RCSB PDB site
Description: d-amino acic oxidase in complex with d-alanine and a partially occupied biatomic species
Class: oxidoreductase
Keywords: alpha-beta-alpha motif, flavin containing protein, oxidase, oxidoreductase
Deposited on 1999-07-19, released 2000-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.125
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid oxidase
    Species: Rhodosporidium toruloides [TaxId:5286]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80324 (2-362)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1c0pa1, d1c0pa2, d1c0pa3
  • Heterogens: FAD, DAL, PER, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0pA (A:)
    lmmhsqkrvvvlgsgviglssalilarkgysvhilardlpedvssqtfaspwaganwtpf
    mtltdgprqakweestfkkwvelvptghamwlkgtrrfaqnedgllghwykditpnyrpl
    pssecppgaigvtydtlsvhapkycqylarelqklgatferrtvtsleqafdgadlvvna
    tglgaksiagiddqaaepirgqtvlvkspckrctmdssdpaspayiiprpggevicggty
    gvgdwdlsvnpetvqrilkhclrldptissdgtiegievlrhnvglrparrggprveaer
    ivlpldrtksplslgrgsaraakekevtlvhaygfssagyqqswgaaedvaqlvdeafqr
    yhg