PDB entry 1c0p

View 1c0p on RCSB PDB site
Description: d-amino acic oxidase in complex with d-alanine and a partially occupied biatomic species
Deposited on 1999-07-19, released 2000-11-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-22, with a file datestamp of 2000-11-22.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.125
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0pA (A:)
    lmmhsqkrvvvlgsgviglssalilarkgysvhilardlpedvssqtfaspwaganwtpf
    mtltdgprqakweestfkkwvelvptghamwlkgtrrfaqnedgllghwykditpnyrpl
    pssecppgaigvtydtlsvhapkycqylarelqklgatferrtvtsleqafdgadlvvna
    tglgaksiagiddqaaepirgqtvlvkspckrctmdssdpaspayiiprpggevicggty
    gvgdwdlsvnpetvqrilkhclrldptissdgtiegievlrhnvglrparrggprveaer
    ivlpldrtksplslgrgsaraakekevtlvhaygfssagyqqswgaaedvaqlvdeafqr
    yhg