PDB entry 1c0m

View 1c0m on RCSB PDB site
Description: crystal structure of rsv two-domain integrase
Deposited on 1999-07-16, released 2000-03-01
The last revision prior to the SCOP 1.57 freeze date was dated 2000-06-26, with a file datestamp of 2000-06-26.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.216
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0mA (A:)
    gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
    iavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrir
    vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkiri
    etgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0mB (B:)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrirvlaeg
    dgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkirietgew
    ekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0mC (C:)
    gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
    iavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrir
    vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkiri
    etgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdit
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0mD (D:)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrirvlaeg
    dgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkirietgew
    ekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi