PDB entry 1c0k

View 1c0k on RCSB PDB site
Description: crystal structure analysis of d-amino acid oxidase in complex with l-lactate
Class: oxidoreductase
Keywords: flavin containing protein, alpha-beta-alpha motif, oxidoreductase
Deposited on 1999-07-16, released 2000-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.115
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (d-amino acid oxidase)
    Species: Rhodosporidium toruloides [TaxId:5286]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80324 (2-362)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1c0ka1, d1c0ka2, d1c0ka3
  • Heterogens: FAD, LAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0kA (A:)
    lmmhsqkrvvvlgsgviglssalilarkgysvhilardlpedvssqtfaspwaganwtpf
    mtltdgprqakweestfkkwvelvptghamwlkgtrrfaqnedgllghwykditpnyrpl
    pssecppgaigvtydtlsvhapkycqylarelqklgatferrtvtsleqafdgadlvvna
    tglgaksiagiddqaaepirgqtvlvkspckrctmdssdpaspayiiprpggevicggty
    gvgdwdlsvnpetvqrilkhclrldptissdgtiegievlrhnvglrparrggprveaer
    ivlpldrtksplslgrgsaraakekevtlvhaygfssagyqqswgaaedvaqlvdeafqr
    yhg