PDB entry 1c0i

View 1c0i on RCSB PDB site
Description: crystal structure of d-amino acid oxidase in complex with two anthranylate molecules
Class: oxidoreductase
Keywords: flavin containing protein, alpha-beta-alpha motif, oxidoreductase
Deposited on 1999-07-16, released 2002-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid oxidase
    Species: Rhodosporidium toruloides [TaxId:5286]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80324 (2-362)
      • conflict (0-1)
    Domains in SCOPe 2.07: d1c0ia1, d1c0ia2, d1c0ia3
  • Heterogens: FAD, BE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0iA (A:)
    lmmhsqkrvvvlgsgviglssalilarkgysvhilardlpedvssqtfaspwaganwtpf
    mtltdgprqakweestfkkwvelvptghamwlkgtrrfaqnedgllghwykditpnyrpl
    pssecppgaigvtydtlsvhapkycqylarelqklgatferrtvtsleqafdgadlvvna
    tglgaksiagiddqaaepirgqtvlvkspckrctmdssdpaspayiiprpggevicggty
    gvgdwdlsvnpetvqrilkhclrldptissdgtiegievlrhnvglrparrggprveaer
    ivlpldrtksplslgrgsaraakekevtlvhaygfssagyqqswgaaedvaqlvdeafqr
    yhg