PDB entry 1c0e

View 1c0e on RCSB PDB site
Description: Active Site S19A Mutant of Bovine Heart Phosphotyrosyl Phosphatase
Deposited on 1999-07-15, released 1999-09-28
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-06, with a file datestamp of 1999-10-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c0ea_
  • Chain 'B':
    Domains in SCOP 1.55: d1c0eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0eA (A:)
    vtksvlfvclgnicrapiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
    rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
    qliiedpyygndadfetvyqqcvrccraflekvr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0eB (B:)
    vtksvlfvclgnicrapiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
    rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
    qliiedpyygndadfetvyqqcvrccraflekvr