PDB entry 1c0e

View 1c0e on RCSB PDB site
Description: Active Site S19A Mutant of Bovine Heart Phosphotyrosyl Phosphatase
Class: hydrolase
Keywords: tyrosine phosphatase, phosphatase dimer, hydrolase
Deposited on 1999-07-15, released 1999-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tyrosine phosphatase (orthophosphoric monoester phosphohydrolase))
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11064
      • engineered (18)
    Domains in SCOPe 2.07: d1c0ea_
  • Chain 'B':
    Compound: protein (tyrosine phosphatase (orthophosphoric monoester phosphohydrolase))
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c0eb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c0eA (A:)
    aeqvtksvlfvclgnicrapiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
    sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
    pqkqliiedpyygndadfetvyqqcvrccraflekvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0eA (A:)
    vtksvlfvclgnicrapiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
    rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
    qliiedpyygndadfetvyqqcvrccraflekvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c0eB (B:)
    aeqvtksvlfvclgnicrapiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
    sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
    pqkqliiedpyygndadfetvyqqcvrccraflekvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0eB (B:)
    vtksvlfvclgnicrapiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdpravscl
    rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
    qliiedpyygndadfetvyqqcvrccraflekvr