PDB entry 1c0d

View 1c0d on RCSB PDB site
Description: endocellulase e1 from acidothermus cellulolyticus mutant y245g
Class: hydrolase
Keywords: alpha/beta barrel, endo-1,4-beta-d-glucanase
Deposited on 1999-07-15, released 1999-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2005-07-05, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endocellulase e1 from a. cellulolyticus
    Species: Acidothermus cellulolyticus
    Domains in SCOPe 2.06: d1c0da_
  • Chain 'B':
    Compound: endocellulase e1 from a. cellulolyticus
    Species: Acidothermus cellulolyticus
    Domains in SCOPe 2.06: d1c0db_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0dA (A:)
    agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
    irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
    sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
    aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
    atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
    qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0dB (B:)
    agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
    irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
    sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
    aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
    atsvgpqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
    qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtdkdgylapikssifdpv