PDB entry 1c0c

View 1c0c on RCSB PDB site
Description: bovine pancreatic ribonuclease a desiccated for 4.0 days
Class: hydrolase
Keywords: hydrolase (phosphoric diester, RNA), desiccated, dry, dehydrated, hydrolase
Deposited on 1999-07-15, released 1999-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c0ca_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c0cA (A:)
    pslgketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqa
    vcsqknvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyv
    pvhfdasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0cA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv