PDB entry 1c0a

View 1c0a on RCSB PDB site
Description: crystal structure of the e. coli aspartyl-tRNA synthetase : trnaasp : aspartyl-adenylate complex
Class: ligase/RNA
Keywords: protein-RNA complex, ligase/RNA complex
Deposited on 1999-07-15, released 1999-11-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartyl tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1c0aa1, d1c0aa2, d1c0aa3
  • Chain 'B':
    Compound: aspartyl tRNA
    Species: Escherichia coli [TaxId:562]
    Gene:
  • Heterogens: SO4, AMP, AMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c0aA (A:)
    mrteycgqlrlshvgqqvtlcgwvnrrrdlgslifidmrdregivqvffdpdradalkla
    selrnefciqvtgtvrardekninrdmatgeievlassltiinradvlpldsnhvnteea
    rlkyryldlrrpemaqrlktrakitslvrrfmddhgfldietpmltkatpegardylvps
    rvhkgkfyalpqspqlfkqllmmsgfdryyqivkcfrdedlradrqpeftqidvetsfmt
    apqvrevmealvrhlwlevkgvdlgdfpvmtfaeaerrygsdkpdlrnpmeltdvadllk
    svefavfagpandpkgrvaalrvpggasltrkqideygnfvkiygakglayikvnerakg
    leginspvakflnaeiiedildrtaaqdgdmiffgadnkkivadamgalrlkvgkdlglt
    deskwaplwvidfpmfeddgeggltamhhpftspkdmtaaelkaapenavanaydmving
    yevgggsvrihngdmqqtvfgilgineeeqrekfgflldalkygtpphaglafgldrltm
    lltgtdnirdviafpkttaaaclmteapsfanptalaelsiqvvk
    

  • Chain 'B':
    No sequence available.