PDB entry 1c07

View 1c07 on RCSB PDB site
Description: structure of the third eps15 homology domain of human eps15
Deposited on 1999-07-14, released 2000-07-19
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c07a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c07A (A:)
    twvvspaekakydeiflktdkdmdgfvsglevreiflktglpstllahiwslcdtkdcgk
    lskdqfalafhlisqklikgidpphvltpemipps