PDB entry 1c07

View 1c07 on RCSB PDB site
Description: structure of the third eps15 homology domain of human eps15
Class: signaling protein
Keywords: calcium binding, signaling domain, npf binding, fw binding, ef-hand, eh domain, signaling protein
Deposited on 1999-07-14, released 2000-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (epidermal growth factor receptor pathway substrate 15)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c07a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c07A (A:)
    twvvspaekakydeiflktdkdmdgfvsglevreiflktglpstllahiwslcdtkdcgk
    lskdqfalafhlisqklikgidpphvltpemipps