PDB entry 1c06

View 1c06 on RCSB PDB site
Description:
Deposited on 1999-07-14, released 1999-09-24
The last revision prior to the SCOP 1.67 freeze date was dated 2000-02-04, with a file datestamp of 2000-02-04.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1c06a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c06A (A:)
    mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
    glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
    pdylsfdpekmegtytrlperselpaeinealivefysr