PDB entry 1c06

View 1c06 on RCSB PDB site
Description: solution structure of ribosomal protein s4 delta 41, refined with dipolar couplings (ensemble of 16 structures)
Class: ribosome
Keywords: two subdomains, unique topology, possible helix-turn helix motif, ribosome
Deposited on 1999-07-14, released 1999-09-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s4 delta 41
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c06a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c06A (A:)
    mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
    glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
    pdylsfdpekmegtytrlperselpaeinealivefysr