PDB entry 1c04

View 1c04 on RCSB PDB site
Description: identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui
Deposited on 1999-07-14, released 1999-08-31
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 5 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein l2
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ribosomal protein l6
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ribosomal protein l11
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ribosomal protein l14
    Species: Haloarcula marismortui [TaxId:2238]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 23s rRNA fragment
    Species: Haloarcula marismortui [TaxId:2238]
  • Chain 'F':
    Compound: 23s rRNA fragment
    Species: Haloarcula marismortui [TaxId:2238]

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.55, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1c04A (A:)
    qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
    dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
    vrmilgkcratvgevgn
    

    Sequence, based on observed residues (ATOM records):
    >1c04A (A:)
    qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
    dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
    vrmilgkcratvgev
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1c04B (B:)
    srvgkkpieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhh
    ralhgttrsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegl
    eievpsqtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrlkegktgk
    

    Sequence, based on observed residues (ATOM records):
    >1c04B (B:)
    pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
    trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
    qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1c04C (C:)
    ktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaamrmieg
    tarsmgi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1c04D (D:)
    miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
    vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
    vi
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.