PDB entry 1c02

View 1c02 on RCSB PDB site
Description: crystal structure of yeast ypd1p
Class: transferase
Keywords: helix-bundle, transferase
Deposited on 1999-07-14, released 2000-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotransferase ypd1p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c02a_
  • Chain 'B':
    Compound: phosphotransferase ypd1p
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c02b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c02A (A:)
    stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
    lghflkgssaalglqriawvceriqnlgrkmqhffpnktelvntlsdksiinginidedd
    eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c02B (B:)
    stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
    lghflkgssaalglqriawvceriqnlgrkmqhffpnktelvntlsdksiinginidedd
    eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl