PDB entry 1c01

View 1c01 on RCSB PDB site
Description: solution structure of miamp1, a plant antimicrobial protein
Class: antimicrobial protein
Keywords: greek key, beta-barrel, antimicrobial protein
Deposited on 1999-07-13, released 2000-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antimicrobial peptide 1
    Species: Macadamia integrifolia [TaxId:60698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c01a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c01A (A:)
    saftvwsgpgcnnraeryskcgcsaihqkggydfsytgqtaalynqagcsgvahtrfgss
    aracnpfgwksifiqc