PDB entry 1bzy

View 1bzy on RCSB PDB site
Description: human hgprtase with transition state inhibitor
Deposited on 1998-11-05, released 1999-06-22
The last revision prior to the SCOP 1.71 freeze date was dated 1999-06-22, with a file datestamp of 1999-06-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1bzya_
  • Chain 'B':
    Domains in SCOP 1.71: d1bzyb_
  • Chain 'C':
    Domains in SCOP 1.71: d1bzyc_
  • Chain 'D':
    Domains in SCOP 1.71: d1bzyd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bzyA (A:)
    atrspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghh
    ivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggdd
    lstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgf
    eipdkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzyA (A:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bzyB (B:)
    atrspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghh
    ivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggdd
    lstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgf
    eipdkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzyB (B:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bzyC (C:)
    atrspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghh
    ivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggdd
    lstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgf
    eipdkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzyC (C:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bzyD (D:)
    atrspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghh
    ivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggdd
    lstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgf
    eipdkfvvgyaldyneyfrdlnhvcvisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzyD (D:)
    spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
    ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
    dkfvvgyaldyneyfrdlnhvcvisetgkakyka