PDB entry 1bzs

View 1bzs on RCSB PDB site
Description: crystal structure of mmp8 complexed with hmr2909
Class: hydrolase
Keywords: metallo proteinase, hydroxamate, matrix degradation, hydrolase
Deposited on 1998-11-04, released 2000-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neutrophil collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22894 (0-164)
      • conflict (164)
    Domains in SCOPe 2.08: d1bzsa_
  • Heterogens: CA, ZN, BSI, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzsA (A:)
    fmltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadi
    niafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahe
    fghslglahssdpgalmypnyafretsnyslpqddidgiqaiygd