PDB entry 1bzq

View 1bzq on RCSB PDB site
Description:
Deposited on 1998-11-03, released 1998-11-11
The last revision prior to the SCOP 1.65 freeze date was dated 1999-12-15, with a file datestamp of 1999-12-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22234
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bzqa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bzqb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bzqc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bzqd_
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bzqk_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bzql_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bzqm_
  • Chain 'N':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bzqn_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzqA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzqB (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzqC (C:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzqD (D:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzqK (K:)
    qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
    adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
    srgr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzqL (L:)
    qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
    adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
    srgr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzqM (M:)
    qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
    adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
    srgr
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzqN (N:)
    qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
    adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
    srgr