PDB entry 1bzo

View 1bzo on RCSB PDB site
Description: three-dimensional structure of prokaryotic cu,zn superoxide dismutase from p.leiognathi, solved by x-ray crystallography.
Deposited on 1998-11-02, released 1999-04-09
The last revision prior to the SCOP 1.65 freeze date was dated 2000-12-27, with a file datestamp of 2000-12-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1bzoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzoA (A:)
    qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgmhgfhihqngscassekdgk
    vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
    aimihaggdnhsdmpkalggggarvacgviq