PDB entry 1bzo

View 1bzo on RCSB PDB site
Description: three-dimensional structure of prokaryotic cu,zn superoxide dismutase from p.leiognathi, solved by x-ray crystallography.
Class: oxidoreductase
Keywords: monomeric cu, zn superoxide dismutase, protein-subunit recognition, protein electrostatic, oxidoreductase
Deposited on 1998-11-02, released 1999-04-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (superoxide dismutase)
  Species: Photobacterium leiognathi [TaxId:658]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00446 (0-150)
    • see remark 999 (30)
  Domains in SCOPe 2.08: d1bzoa_
• Heterogens: ZN, CU, IUM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bzoA (A:)
  qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgmhgfhihqngscassekdgk
  vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
  aimihaggdnhsdmpkalggggarvacgviq