PDB entry 1bzk

View 1bzk on RCSB PDB site
Description: structural studies on the effects of the deletion in the red cell anion exchanger (band3, ae1) associated with south east asian ovalocytosis.
Class: transport protein
Keywords: human erythrocyte anion transporter, transmembrane, synthetic peptide, nmr, transport protein
Deposited on 1998-11-01, released 1999-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (band 3 anion transport protein)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bzka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzkA (A:)
    rypyylsditdafspqvlaavifiyfaalspaitfggllgek