PDB entry 1bzf

View 1bzf on RCSB PDB site
Description: nmr solution structure and dynamics of the complex of lactobacillus casei dihydrofolate reductase with the new lipophilic antifolate drug trimetrexate, 22 structures
Deposited on 1998-10-28, released 1999-05-18
The last revision prior to the SCOP 1.59 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1bzf__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bzf_ (-)
  taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
  vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
  sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka