PDB entry 1bzd

View 1bzd on RCSB PDB site
Description: tertiary structures of three amyloidogenic transthyretin variants and implications for amyloid fibril formation
Class: binding protein
Keywords: thyroid hormone, liver, plasma, cerebrospinal fluid, polyneuropathy, disease mutation, transport, thyroxine, binding protein
Deposited on 1998-10-28, released 1998-11-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transthyretin)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • engineered (5)
    Domains in SCOPe 2.05: d1bzda_
  • Chain 'B':
    Compound: protein (transthyretin)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • engineered (5)
    Domains in SCOPe 2.05: d1bzdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzdA (A:)
    gptgtseskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzdB (B:)
    gptgtseskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke