PDB entry 1bzd

View 1bzd on RCSB PDB site
Description: tertiary structures of three amyloidogenic transthyretin variants and implications for amyloid fibril formation
Class: binding protein
Keywords: thyroid hormone, liver, plasma, cerebrospinal fluid, polyneuropathy, signal, polymorphism, disease mutation, transport, thyroxine
Deposited on 1998-10-28, released 1998-11-04
The last revision prior to the SCOP 1.73 freeze date was dated 1999-12-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transthyretin)
    Species: Homo sapiens, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • engineered (5)
    Domains in SCOP 1.73: d1bzda_
  • Chain 'B':
    Compound: protein (transthyretin)
    Species: Homo sapiens, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-126)
      • engineered (5)
    Domains in SCOP 1.73: d1bzdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bzdA (A:)
gptgtseskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bzdB (B:)
gptgtseskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke