PDB entry 1bza

View 1bza on RCSB PDB site
Description: beta-lactamase toho-1 from escherichia coli tuh12191
Class: hydrolase
Keywords: hydrolase, beta-lactamase
Deposited on 1998-10-28, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli [TaxId:562]
    Gene: bla
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47066 (3-End)
      • conflict (6)
      • conflict (8-9)
      • conflict (12-13)
      • conflict (50)
      • conflict (56)
      • conflict (60-62)
      • conflict (87)
      • conflict (91)
      • conflict (96)
      • conflict (106)
      • conflict (113)
      • conflict (115)
      • conflict (119-120)
      • conflict (127)
      • engineered (139)
      • conflict (155)
      • conflict (157)
      • conflict (164)
      • conflict (173-175)
      • conflict (184)
      • conflict (191)
      • conflict (195)
      • conflict (200)
      • conflict (225-227)
      • conflict (231)
      • conflict (240-241)
      • conflict (245)
      • conflict (249)
      • conflict (252)
    Domains in SCOPe 2.07: d1bzaa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bzaA (A:)
    ansvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqses
    dkhllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpd
    kvtafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraq
    lvtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqp
    eqkaerrrdilaaaakivthgf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzaA (A:)
    svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
    hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
    tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
    twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
    kaerrrdilaaaakivt