PDB entry 1bz8

View 1bz8 on RCSB PDB site
Description: transthyretin (del val122)
Class: signaling protein
Keywords: thyroid hormone, liver, plasma, cerebrospinal fluid, polyneuropathy, signal, polymorphism, disease mutation, deletion mutant, transport, thyroxine, signaling protein
Deposited on 1998-11-08, released 1998-11-11
The last revision prior to the SCOP 1.73 freeze date was dated 1999-12-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transthyretin)
    Species: Homo sapiens, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bz8a_
  • Chain 'B':
    Compound: protein (transthyretin)
    Species: Homo sapiens, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bz8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bz8A (A:)
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vtnpke

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bz8B (B:)
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vtnpke