PDB entry 1bz8

View 1bz8 on RCSB PDB site
Description: transthyretin (del val122)
Class: signaling protein
Keywords: thyroid hormone, liver, plasma, cerebrospinal fluid, polyneuropathy, disease mutation, deletion mutant, transport, thyroxine, signaling protein
Deposited on 1998-11-08, released 1998-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transthyretin)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bz8a_
  • Chain 'B':
    Compound: protein (transthyretin)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bz8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bz8A (A:)
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vtnpke

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bz8B (B:)
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vtnpke