PDB entry 1bz7

View 1bz7 on RCSB PDB site
Description: fab fragment from murine ascites
Class: immune system
Keywords: antibody (fab fragment), immune system
Deposited on 1998-11-06, released 1999-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.162
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (antibody r24 (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BZ7 (0-205)
    Domains in SCOPe 2.05: d1bz7a1, d1bz7a2
  • Chain 'B':
    Compound: protein (antibody r24 (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BZ7 (0-216)
    Domains in SCOPe 2.05: d1bz7b1, d1bz7b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bz7A (A:)
    diqmtqitsslsvslgdrviiscrasqdignflnwyqqkpdgslklliyytsrlqsgvps
    rfsgwgsgtdysltisnleeediatffcqqgktlpytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bz7B (B:)
    dvqlvesggglvqpggsrklscaasgftfsnfgmhwvrqapekglewvayissggssiny
    adtvkgrftisrdnpkntlflqmtslrsedtaiyyctrggtgtrslyyfdywgqgatliv
    ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdk