PDB entry 1bz4

View 1bz4 on RCSB PDB site
Description: apolipoprotein e3 (apo-e3), truncation mutant 165
Class: lipid binding protein
Keywords: lipid transport, heparin-binding, plasma protein, hdl, vldl, lipid binding protein
Deposited on 1998-11-05, released 1998-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: -3.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (apolipoprotein e)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bz4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bz4A (A:)
    sgqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeq
    ltpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashl
    rklrkrllrdaddlqkrlavyqag