PDB entry 1byy

View 1byy on RCSB PDB site
Description: sodium channel iia inactivation gate
Class: membrane protein
Keywords: sodium channel, membrane protein
Deposited on 1998-10-21, released 1999-10-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (sodium channel alpha-subunit)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04775
  Domains in SCOPe 2.08: d1byya_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1byyA (A:)
  dnfnqqkkkfggqdifmteeqkkyynamkklgskkpqkpiprpankfqgmvfd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1byyA (A:)
  qdifmteeqkkyynamkklgs