PDB entry 1byw

View 1byw on RCSB PDB site
Description: structure of the n-terminal domain of the human-erg potassium channel
Class: membrane protein
Keywords: pas domain, potassium channel domain, membrane protein
Deposited on 1998-10-15, released 1998-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.252
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (human erg potassium channel)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12809 (0-109)
      • mutation (47)
    Domains in SCOPe 2.07: d1bywa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bywA (A:)
    srkfiianarvencaviycndgfcelcgysraevmqrpctcdflhgpctqrraaaqiaqa
    llgaeerkveiafyrkdgscflclvdvvpvknedgavimfilnfevvmek