PDB entry 1byw

View 1byw on RCSB PDB site
Description: structure of the n-terminal domain of the human-erg potassium channel
Class: membrane protein
Keywords: pas domain, potassium channel domain, membrane protein
Deposited on 1998-10-15, released 1998-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (human erg potassium channel)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12809 (0-109)
    • engineered mutation (47)
  Domains in SCOPe 2.08: d1bywa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bywA (A:)
  srkfiianarvencaviycndgfcelcgysraevmqrpctcdflhgpctqrraaaqiaqa
  llgaeerkveiafyrkdgscflclvdvvpvknedgavimfilnfevvmek