PDB entry 1byv

View 1byv on RCSB PDB site
Description: glycosylated eel calcitonin
Deposited on 1998-10-16, released 1998-10-28
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (calcitonin)
    Species: Anguilla japonica [TaxId:7937]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.57, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1byvA (A:)
csnlstcvlgklsqelhklqtyprtdvgagtp